[HTML payload içeriği buraya]
31.5 C
Jakarta
Saturday, June 20, 2026

Injective hydrogel loaded with liposomes-encapsulated MY-1 promotes wound therapeutic and will increase tensile power by accelerating fibroblast migration by way of the PI3K/AKT-Rac1 signaling pathway | Journal of Nanobiotechnology


Design and synthesis of MY-1 peptide

Based mostly on the amino acid sequence of PTH(1–34), MY-1 was designed by truncating the important thing amino acid area of PTH(1–2) and duplicating the important thing acid area of PTH(29–34). As beforehand reported, the sequence of MY-1 was SEIQLMHNLGKHLNSMERVEWLRKKLQDVHNYQDVHNY [36]. MY-1 and MY-1-FITC had been synthesized with the help of Mecklin Co., Ltd. (Shanghai, China). The focus and elemental composition of the MY-1 peptide had been verified by mass spectrometry, confirming a purity of over 95%.

Fabrication of MY-1-encapsulated liposomes (MY@Lipo)

Soybean phosphatidylcholine (SPC), ldl cholesterol, and 1,2-distearoyl-sn-glycero-3-phosphoethanolamine-N-[methoxy(polyethylene glycol)-2000] (DSPE-PEG-2000) had been co-dissolved in 3 mL of chloroform and subsequently evaporated beneath lowered stress to create a lipid movie inside a pattern vial. Subsequently, 0.5 mg of the MY-1 or MY-1–FITC was launched, and the combination supplemented with 2 mL of deionized water. Then, the answer was subjected to sonication and extruded by means of a liposome extruder with a polycarbonate membrane (pore measurement: 100 nm; Whatman, Maiterstone, England). Following this, the pattern underwent dialysis using a nanodialysis gadget geared up with a polycarbonate membrane (pore measurement: 30 nm) to get rid of any unencapsulated peptides. Lastly, the quantity was adjusted to three mL with deionized water and subjected to lyophilization.

Characterization of MY@Lipo

The hydrodynamic diameter of recent liposomes was detected by dynamic mild scattering (DLS). The polydispersity index (PDI) and zeta potential had been measured by the section evaluation of sunshine scattering (PALS) with the NanoBrook 90 plus PALS particle measurement and zeta potential analyzer (Bruker, Berlin, Germany). The morphology and stability of MY@Lipo and empty liposomes was evaluated by transmission electron microscope (TEM) (TF20; FEI, Hillsboro, USA).

The encapsulation effectivity (EE) and drug loading (DL) capability had been obtained by way of the ultraviolet-visible (UV–Vis) absorbance of MY–FITC (as an indicator) utilizing the absorbance methodology. The EE (%) of MY@Lipo was calculated by way of the next equation: EE (%) = (the quantity of whole peptide – the quantity of free peptide) / the quantity of whole peptide × 100%. In the meantime, the DL (%) of MY@Lipo was calculated using the next formulation: (the quantity of whole peptide – the quantity of free peptide) / the entire weight of MY@Lipo × 100%.

Preparation and characterization of GelMA/GML hydrogels

5% (w/v) GelMA hydrogels had been ready in keeping with the producer’s directions (EFL-Tech Co., Ltd. Suzhou, China) and our earlier report [25]. Briefly, 1 g of GelMA was utterly dissolved into 20 ml of 0.25% lithium phenyl-2,4,6-trimethylbenzoylphosphinate resolution at 65 ℃ for 30 min. Then, the answer was filtered by way of a 0.22 μm filter (Millipore, Shanghai, China) and saved at 4 ℃ in a darkish location for additional experiments. MY@Lipo was added to the GelMA resolution at 37 ℃ (GML hydrogel) and cross-linked for 40 s by ultraviolet mild (365 nm wavelength, 5 watts energy) instantly or saved at 4 ℃ in a darkish location for additional utilization.

Morphology and structural characterization of hydrogels

The morphologies of the crosslinked GelMA and GML hydrogels had been noticed with a area emission scanning digital microscope (FE-SEM) (Sigma 300; Carl Zeiss). The diameter of the pores was measured. Power dispersive spectrometry (EDS) evaluation was subsequently carried out to evaluate the fundamental composition of the 2 varieties of hydrogels. To look at the distribution of MY@Lipo within the hydrogels, the liposomes had been first labeled with Dio (Beyotime, Shanghai, China) for 30 min after which integrated into the hydrogel. After 40 s of ultraviolet irradiation, the distribution of liposomes within the GML–Dio hydrogel was noticed by confocal microscope (LSM980, Carl Zeiss, Oberkochen, Germany) and the 3D photos had been subsequently reconstructed. The chemical composition of the GelMA and GML was characterised by Fourier transform-infrared spectroscopy (FTIR) (Vector 33; Bruker, Berlin, Germany) with the wavelength within the 500–4000 cm− 1 vary and a 4 cm− 1 decision.

Swelling and degradation assay

To detect the swelling character of the hydrogels, the GelMA and GML had been lyophilized and weighed as M(0). The hydrogels had been immersed in PBS and positioned in an incubator at 37 ℃. On the time factors of 1, 3, 6, 12, 24, and 36 h, the water exterior the hydrogels was eliminated and the weights of the swelling hydrogels had been measured as M(1). The swelling ratio of every time level was calculated utilizing the next equation: swelling ratio (%) = (M(l) – M(0)) / M(0) × 100%.

For the degradation assay, hydrogel samples (100 µL) had been first ready into cylinders and cross-linked with ultraviolet mild. The samples on day 0 had been lyophilized, and their weights had been recorded as W0. Equivalent volumes of hydrogel samples had been immersed in PBS and incubated at 37 °C. At every time level, samples had been faraway from the PBS, lyophilized, and weighed to find out the remaining weight (W1). The degradation price at every time level was calculated utilizing the next equation: degradation ratio (%) = (W1 / W0) × 100%.

MY-1 launch assay

For the in vitro MY-1 launch assay, a regular curve was generated to correlate the optical density (OD) worth of the FITC with graded concentrations of MY-1–FITC. Then, the GML–FITC was cross-linked, immersed in 10 mL PBS in centrifuge tubes, and positioned in a shaker at 37 °C in a darkish location. The 100 µL supernatants had been collected at a sure time level, and an equal quantity of PBS was added to the system. The OD values of the supernatants had been measured by way of the Spectra Max i3x multi-mode microplate reader (Molecular Units Co., Ltd., San Jose, CA, USA) at an excitation wavelength of 488 nm, and subsequently entered into the formulation of ordinary curve to calculate the concentrations of MY-1 at every time level. An in vivo peptide releasing check was carried out on rat pores and skin wound fashions, with the fluorescence intensities and areas detected by an in vivo imaging system.

In vitro and in vivo biocompatibility evaluation

For in vitro biocompatibility testing, GML containing serial concentrations of MY-1(0, 0.01, 0.1, 1, or 10 µg per 100 µL gel) was generated and positioned within the higher chamber of an 8 μm pore-size transwell plate, then the first rat dermal fibroblasts had been cultured within the decrease chamber of the plate in DMEM medium that submerged the hydrogel. After 24 h, the first rat dermal fibroblasts had been stained using a Calcein-AM/PI package (Beyotime) in keeping with the producer’s directions. Residing cells exhibited inexperienced fluorescence and lifeless cells had been stained in pink. In vivo biocompatibility testing was performed on rat pores and skin wound fashions with hydrogels carrying completely different concentrations of MY-1, as talked about above, with the in vivo biocompatibility demonstrated by the wound width at day 7.

Animal experiments

Male SD rats (SPF, 250 ± 30 g) had been bought from the Animal Middle of Southern Medical College, Guangdong Province, China. All animal experiments concerned on this examine strictly complied with the steerage for the care and use of laboratory animals, and the protocols had been authorized by the Moral Committee of the Laboratory Animal Middle of Southern Medical College (Grant No. NFYY-2022-0417). The rats had been housed beneath normal temperature and humidity circumstances, with a 12 h mild/darkish cycle and free entry to meals and water. Earlier than surgical procedure, all rats had been anesthetized by gaseous anesthesia with the inhalation of isoflurane, and the dorsal hairs had been shaved with a razor and additional depilated with depilatory cream. Then, the dorsal pores and skin was sterilized with alcohol-impregnated gauze and two symmetric full-thickness pores and skin wounds (diameter: 15 mm) had been created on the again of animals with the assistance of a puncher and scissors. With the intention to homogenize the wound contraction and mark the sting, a rubber ring was sewn across the pores and skin wound.

The in vivo experiments had been divided into three levels. Within the first stage, the rat fashions had been randomly subdivided into six teams and the wound was full of 100 µL GelMA (group Gel), or GML teams with MY-1 at 0.1–10 µg. Within the second stage, the rat fashions had been randomly subdivided into 4 teams and the wound was full of 100 µL of PBS (group Clean), GelMA (group Gel), GelMA–liposome (group GL), or GelMA–MY@Lipo (group GML). Within the third stage of the in vivo experiment, a PI3K/AKT signaling inhibitor, LY294002 ([LY]; Beyotime), was loaded into the GelMA at 100 µg per wound. The rat fashions had been randomly subdivided into 4 teams and the pores and skin defects had been full of GelMA–Lipo, GML, GelMA–Lipo–LY, or GML–LY, respectively. After that, all pores and skin wounds had been overlaid by Tegaderm™ movie (3 M Well being Care, St. Paul, MN, USA) and guarded with gauzes and bandages. The pores and skin wounds had been photographed at sure intervals of time post-operation. The wound areas at day 0 and the opposite time factors had been measured with the Picture J software program (recorded as A0 and At, respectively). The remaining wound space was calculated as a share utilizing the next formulation: remaining wound space = At / A0 × 100%. At days 3, 7, and 14, the animals had been euthanatized, and the dorsal pores and skin samples had been harvested and glued in 4% paraformaldehyde (Leagene, Beijing, China).

Tensile power measurement

At day 14, the rat fashions had been euthanized. Centered on the wound, recent full-thickness rectangular pores and skin samples sized 1 cm × 0.5 cm had been remoted. Then, the samples had been mounted on the tensiometer of an digital common testing machine (Aoke Testing Instrument Co., Ltd. Guangzhou, Guangdong Province, China), at each ends alongside the lengthy axis. The stretch energy was utilized evenly alongside the quick fringe of the oblong pores and skin samples and the stretch velocity was set at 10 mm/min. The very best energy previous to the breakage was outlined because the tensile power of every pattern.

Histological evaluation

After being mounted in 4% paraformaldehyde for twenty-four h, the pores and skin samples had been dehydrated, embedded, and sectioned following a regular protocol. 4-micrometer-thick sections had been dewaxed and processed with a hematoxylin-eosin (HE) staining and Masson’s trichrome staining. For the exhibition of collagen, the samples had been reduce into 6-µm-thick sections and dewaxed, adopted by immersion in picrosirius pink for 1 h at room temperature. The sections had been then washed twice in water, stained with Mayer hematoxylin for 8 min, and quickly dehydrated in xylene. The depositions of collagen I and collagen III fibers had been detected by mild and polarized mild microscopy (BX53P; Olympus, Tokyo, Japan). The pictures had been analyzed using the Picture J software program, as beforehand described.

For immunohistochemical (IHC) staining, the sections had been dewaxed and heated in a microwave for antigen retrieval. After that, the sections had been immersed in 3% H2O2 for 15 min, adopted by incubation in goat serum for 30 min at room temperature to dam the antigen. Subsequently, all sections had been incubated in major antibodies in opposition to fibronectin ([FN]; dilution at 1:250; Affinity Biosciences, Beijing, China), Rac1 (dilution at 1:250; Santa Cruz Biotechnology, Cincinnati, OH, USA), p-AKT (dilution at 1:250; Affinity Biosciences) and p-PI3K (dilution at 1:250; Affinity Biosciences) in a single day at 4 ℃. Then, the sections had been incubated with a second antibody for two h at room temperature. The histological photos had been developed with a DAB system (ZSGB-Bio, Beijing, China) and investigated by way of a BX63 microscope (Olympus).

For immunofluorescence (IF) staining, the 4-µm-thick sections had been subjected to dewaxing and antigen retrieval, adopted by 15 min of permeabilization with 0.5% Triton X-100 (Solarbio, Beijing, China). Main antibodies in opposition to Ki67 (dilution at 1:250; Affinity Biosciences) and Vimentin (dilution at 1:250; Santa Cruz) had been utilized. Then, the sections had been incubated in Alexa Fluor 488- or Alexa Fluor 594-conjugated secondary antibodies (Abcam, Cambridge, UK) at room temperature for two h, and the nuclei stained with 4,6-diamidino-2-phenylindole dilactate ([DAPI]; Beyotime). The pictures had been visualized utilizing the LSM-980 confocal microscope.

Cell counting kit-8 assay and colony forming unit assay

The cell viability was detected using a cell counting kit-8 ([CCK-8]; Dojindo, Kumamoto, Japan). Briefly, fibroblasts had been positioned into 96-well plates at a density of two × 103 cells per properly. Serial concentrations of MY-1 within the 1–10 µM vary had been added to the tradition system. After 24–72 h, the medium was eliminated and 100 µL serum-free DMEM containing 10 µL CCK-8 resolution was added, with the answer then incubated at 37 ℃ for 1 h. The OD on the wavelength of 450 nm was measured by way of the Molecular Units Spectra Max i3x multi-mode microplate reader.

Main fibroblasts of the third passage had been seeded in 6-well plates at a density of 1000 cells per properly. Seven days later, the cells in numerous group had been mounted with 4% PFA and stained with 0.1% crystal violet (Leagene) for 15 min. Cell colonies containing 50 or extra cells had been chosen and counted.

Cell migration assays

For the cell scratching assay, fibroblasts had been seeded in 12-well plates at a density of 4.5 × 105 per properly. Previous to scratching, the cells had been pre-stimulated with 10 nM or 100 nM MY-1 or the management for twenty-four h. When the cells reached 100% confluence, a sterile yellow pipette tip was inserted till it firmly touched the bottom of the tradition dish, after which it was moved from one aspect to a different whereas remaining vertical. Subsequent, the floated fibroblasts had been eliminated by washing with PBS. At sure time factors, the cells had been mounted with 4% paraformaldehyde after which stained with rhodamine-phalloidin (Abcam) for 30 min, adopted by staining with DAPI for a further 10 min. Pictures had been taken with an inverted fluorescence microscope (IX73; Olympus). The distinction in cell migration means was outlined as the share of the cells-recovered space in comparison with the unique scratched space.

Transwell assay was carried out to display the cell motility. The first fibroblasts had been pre-treated with 10 nM or 100 nM MY-1 or automobile for twenty-four h previous to being subjected to the transwell assay. A complete of 5 × 104 fibroblasts suspended in 100 µL serum-free medium was seeded into the higher chamber of a 24-well, 8 μm pore-size transwell plate (Corning, NY, USA). The tradition medium containing 2% FBS with or with out MY-1was added into the decrease chamber. Following 48 h of incubation, the cells remaining on the higher aspect of the chambers had been swabbed with cotton swabs, whereas the migrated cells rising on the decrease aspect of the chambers had been mounted in 4% paraformaldehyde for 15 min and stained with 0.1% (w/v) crystal violet (Leagene) for a further 15 min. Pictures of the stained cells had been collected by way of an inverted phase-contrast microscope (IX73; Olympus), and the variety of cells had been quantified.

Wound explant assays had been employed to evaluate the migrating means of cells from the tissue. The dermis was remoted from the dorsal pores and skin of 1-day-old SD rat neonates. Briefly, the pores and skin patches had been harvested and digested with 0.1% dispase (Solarbio) to separate the dermis from dermis. The collected dermis was reduce into small items (diameter: 1 mm) with scissors and positioned right into a properly that was pre-coated with collagen sort I. After incubation with 10% FBS-supplemented medium containing peptides or different brokers for five days, the cells sprouting from the dermis tissue had been investigated by invert microscope (IX73; Olympus). The gap from the dermis tissue to the farthest sprouting edge was measured and normalized because the fold of management (set as 1.0).

Cytoskeleton staining

For cytoskeleton and lamellipodia staining, fibroblasts had been seeded within the 24-well glass cowl slips at a density of 1 × 104 per properly. After adhesion, the whole medium was exchanged with a DMEM medium (with 2% FBS) with or with out MY-1, and particular inhibitors. Then, the fibroblasts in every group had been mounted with 4% PFA for 15 min and stained with rhodamine-phalloidin for 30 min, adopted by 10 min of DAPI staining. The cell morphology and lamellipodia had been noticed utilizing the confocal microscope. The quantity of lamellipodia was outlined as the share of lamellipodia space in comparison with the entire cell space.

Immunofluorescence staining of fibroblasts

The fibroblasts had been mounted with 4% paraformaldehyde for 15 min at room temperature, adopted by permeabilizing with 0.5% (v/v) Triton X-100 (Solarbio) in PBS for 15 min. After washing with PBS, the cells had been blocked in 5% BSA (Solarbio) for 1 h and incubated in major antibodies in a single day at 4 °C. Subsequently, the cells had been washed once more and incubated in Alexa Fluor 488- or 594-conjugated secondary antibodies for two h at room temperature. Lastly, DAPI was utilized to stain the nuclei for 10 min. Fluorescence photos had been noticed by confocal laser scanning microscopy.

Western blot evaluation

The overall protein was extracted using the RIPA lysis buffer (Beyotime) with protease inhibitor (Beyotime) and protein phosphatase inhibitor (Beyotime) on ice. The cell lysates had been then collected and subjected to ultra-sonication for 10 min, adopted by 15 min of centrifugation (4 ℃, 12,000 rpm) and protein focus measurement with the BCA protein assay package (Beyotime). Equal quantities of protein (30 µg per lane) had been subjected to 10% (w/v) SDS-PAGE and transferred to a polyvinylidene fluoride (PVDF) membrane (Millipore). After blocking with the 5% BSA, the PVDF membrane was incubated with major antibodies in opposition to GAPDH (dilution at 1:1000; Affinity Biosciences), Rac1 (dilution at 1:1000), PI3K (dilution at 1:1000), AKT (dilution at 1:1000), p-PI3K (dilution at 1:1000), or p-AKT (dilution at 1:1000) at 4 °C in a single day. The membranes had been then washed with TBST (Beyotime), and incubated with the corresponding HRP-conjugated secondary antibodies for two h at room temperature. The proteins had been visualized by means of chemiluminescence and imaged on an enhanced chemiluminescence agent (BLT Co., Ltd., Guangzhou, China). The protein bands had been quantified by densitometry evaluation by way of the Picture J software program.

siRNA transfection

siRac1 and unfavourable management siRNA had been synthesized by Qingke Co., Ltd. (Beijing, China). siRNA transfection was carried out when the fibroblasts reached 60–80% confluence utilizing Lipo3000 Transfection Reagent (Invitrogen, Carlsbad, CA, USA) in keeping with the producer’s directions.

Statistical evaluation

All quantitative information had been expressed as imply ± normal deviation (SD) from at the very least three repetitive experiments or six animals. For the evaluation of two teams, the unpaired Pupil’s t-test was employed for usually distributed information, whereas the Mann–Whitney U check was utilized for non-normally distributed information. The one-way ANOVA and Tukey’s put up hoc check had been utilized to find out the importance of distinction with SPSS (v.21.0) software program (IBM SPSS Inc., Chicago, IL, USA), the place a price of P < 0.05 was thought of statistically important.

Related Articles

LEAVE A REPLY

Please enter your comment!
Please enter your name here

Latest Articles